DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and Zif

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:519 Identity:98/519 - (18%)
Similarity:179/519 - (34%) Gaps:171/519 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELIDF 75
            ||:|...........::.|..:.:.:.:||..:...:. .:...:.:...:|..|...::....|
  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYS-NLNDREHIPDGICKSCKVELNMAYQF 73

  Fly    76 AEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKPAEL 140
            .|         :.||:       :|::....::.||.|:....:||       |.|...|:    
  Fly    74 RE---------KALRK-------QMEIEEYCRELGLLDESDVMMIK-------EEDGSQQQ---- 111

  Fly   141 LKDFPLAETSSQEMEISKRTTT---THLIQTKKNVE--MEI---PKQEFIDLGPIL--------L 189
                     ..:||.|.:.|||   .|  |.:|..|  :|:   .:||.|  |..:        :
  Fly   112 ---------CDEEMYILEETTTGEEEH--QEEKGHEEYLEVDTSDQQECI--GDTIEYLEDNYTI 163

  Fly   190 EKNTSQ----LDMEDVLDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLM 250
            |.|:.|    |:.|...:|.|.::|            :::...|:. |.:..|            
  Fly   164 EMNSDQTEIVLESEKQYEETPSQQL------------ALQEAAKAS-LKARRG------------ 203

  Fly   251 DLVAVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCD 315
               .|....|:|  |..:..::|...|:.||..|..|....:|..|                   
  Fly   204 ---RVRRGLNSL--TTSDGTEKGGYICDVCGNFYEKRGRMMEHRRR------------------- 244

  Fly   316 ICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKN 380
                               |..:..|.|:.|..:.:....|.:|...||.|:|::|:.|...|..
  Fly   245 -------------------HDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFY 290

  Fly   381 RARLKAHYQIH--AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHL 443
            .:.||:|..:|  .:| :||.:|.|                            .|..:.:|..|.
  Fly   291 ESVLKSHENVHRGIKP-YVCKVCDK----------------------------AFAYAHSLTKHE 326

  Fly   444 LSHTGLRPYVCNYCGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNVPTL------DELRV 501
            |.|:.::.|.|:||.|.|..     .|.:::|.:....::...|...:.|..:      :|:|:
  Fly   327 LIHSDIKLYRCDYCNKDFRL-----LHHMRQHEETKLHQNAVMLAESMKVEMVAEQGGGNEIRI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 10/75 (13%)
COG5048 <313..471 CDD:227381 33/159 (21%)
C2H2 Zn finger 314..335 CDD:275368 0/20 (0%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 4/19 (21%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 13/93 (14%)
C2H2 Zn finger 225..245 CDD:275368 7/57 (12%)
COG5048 <250..369 CDD:227381 35/152 (23%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 10/52 (19%)
C2H2 Zn finger 309..329 CDD:275368 7/47 (15%)
C2H2 Zn finger 337..353 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.