DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG14667

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:244 Identity:60/244 - (24%)
Similarity:95/244 - (38%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 KNTSQLDMEDVLDELPQEELSQPRLDSTTSPASMEND-------VKSEM--LDSCEGDDDFLPVD 246
            |.||  |...|..||..|.|.:..:|:.......::|       .|.|.  |:..|.|||.....
  Fly    83 KKTS--DQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAV 145

  Fly   247 GQLMDLVAVATTPNTLESTAEEKAKRGRMD---CEKCGKVYRNRASYEKHLERECRRIERRVKVD 308
            ....:..|.|.....|:....|:|.:.|.:   |::||.::.:...|.:||.....|.:.     
  Fly   146 IAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDM----- 205

  Fly   309 KTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTV 373
            .....|..|.:|.:....||.|:..:|...:.:.|..|.:...::.|...|...|...||:.|..
  Fly   206 NQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLE 270

  Fly   374 CKAGFKNRARLKAHYQIHAEP--SFVCNICGKKLQTRRTWNMHKVVHTE 420
            |...|.:.:.|:.|:..|::.  .|.|..|.....|||    ..|.||:
  Fly   271 CGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRR----GLVAHTK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 29/110 (26%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368
zf-H2C2_2 439..463 CDD:290200
C2H2 Zn finger 454..475 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 19/73 (26%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.