DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG17359

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:471 Identity:91/471 - (19%)
Similarity:150/471 - (31%) Gaps:146/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRLCAKDDAHGNVKVQMNENSQGN----WDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISE 71
            ||:| :|::...:.:.....:..|    .:.||...:|:.....:..||.:...:|.||...:..
  Fly     7 CRVC-RDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRN 70

  Fly    72 LIDFAEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQK 136
            .........|....||.||                                  .:..|.|::   
  Fly    71 AYRLRRQCRKSHQYFEQLR----------------------------------LMMKELDDI--- 98

  Fly   137 PAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDV 201
                                      .:.:....|:|.::|..        ::|...:....|.:
  Fly    99 --------------------------EYCLNIGDNIEPQMPVS--------VMEAGKTPETSEPL 129

  Fly   202 LDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTA 266
            |.||.|.:...|.....:||....|:.|                   |....:.|.||:      
  Fly   130 LVELVQVKYMPPEPKPISSPLPDNNEHK-------------------LAQSYSPAKTPH------ 169

  Fly   267 EEKAKRGRMDCEKCGKVYRNRASY--EKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKL 329
             .|:||.       .:.|.:..|:  :..||.|        ..||      |.|.:         
  Fly   170 -NKSKRR-------ARSYSDNDSWSPDSELEHE--------DDDK------IWNAS--------- 203

  Fly   330 HKEGIHQNVK-PYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH-A 392
             |.|..:.|. ||.|..|.:.......|..|..:||..||::|::|...|..:..|::|.:.| .
  Fly   204 -KRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTG 267

  Fly   393 EPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYC 457
            |..|.|..|.|:.:......:|...||.|:..||..|...||:...|:.|:.:||.         
  Fly   268 ERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR--------- 323

  Fly   458 GKSFACNANCRSHKLK 473
            ||....:...:.:|.|
  Fly   324 GKRRTSSQETKRNKFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 14/79 (18%)
COG5048 <313..471 CDD:227381 41/159 (26%)
C2H2 Zn finger 314..335 CDD:275368 4/20 (20%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 6/23 (26%)
C2H2 Zn finger 454..475 CDD:275368 4/20 (20%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/81 (20%)
zf-C2H2 215..237 CDD:278523 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 4/19 (21%)
zf-H2C2_2 229..254 CDD:290200 9/24 (38%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 8/24 (33%)
C2H2 Zn finger 273..293 CDD:275368 4/19 (21%)
zf-H2C2_2 286..310 CDD:290200 8/23 (35%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.