DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG15436

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:113/276 - (40%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 MEDVLDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTL 262
            :||.|..|.:||         ....|.:.|.:   :||....||    ||               
  Fly    84 IEDALCALLEEE---------DWEISEDEDAR---IDSASAADD----DG--------------- 117

  Fly   263 ESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATAL 327
                :..:|:...:|.:|.|.|:.:.::.:|:         |..:|..:..|..|.:.......|
  Fly   118 ----KSDSKKVAFECRECHKKYQRKGTFLRHM---------RTHMDGQSFPCPYCKRNFRLRVTL 169

  Fly   328 KLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH- 391
            |.|.: .|...|||.|..|.|.....:.|..|:..||..|||:|:.|...|...:.|:.|.:.| 
  Fly   170 KAHMK-THNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHG 233

  Fly   392 AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNY 456
            :|..|.|:.|.|....:...:.|...||.||..||..|...|...:.||.|...|...||:.|::
  Fly   234 SERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSH 298

  Fly   457 CGKSFACNANCRSHKL 472
            |.|:|..::..:.|||
  Fly   299 CPKTFRLSSTLKEHKL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 49/158 (31%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 7/19 (37%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/28 (21%)
C2H2 Zn finger 156..176 CDD:275368 5/20 (25%)
COG5048 <180..341 CDD:227381 46/135 (34%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
zf-H2C2_2 197..219 CDD:290200 9/21 (43%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
zf-H2C2_2 224..249 CDD:290200 8/24 (33%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-H2C2_2 252..276 CDD:290200 8/23 (35%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.