DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG11695

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:578 Identity:129/578 - (22%)
Similarity:210/578 - (36%) Gaps:163/578 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRLCAKDDAHGNVKVQMNENSQGNW--DNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELI 73
            ||||. |||..:|.: .:::..|:.  .:.|...|.|:.::.:...|.:|..|||:|:..:::..
  Fly     3 CRLCL-DDAEHSVPI-FDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFE 65

  Fly    74 DFAEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKPA 138
            .|...|.|.|...:.|:......|::.|..|   |. ||:.:..  :.|..|...|.:.:.    
  Fly    66 QFCAMVMKKQLGLQQLKMEPFSEDEDADTKA---QI-LCEPEID--VSPAAADNEECNEID---- 120

  Fly   139 ELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVLD 203
                    .:.||.....|.|||:..        ||.:|       .||   :...:|.....  
  Fly   121 --------GDASSNSRSSSIRTTSLR--------EMRLP-------SPI---RRRMRLPRAVT-- 157

  Fly   204 ELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEE 268
             .|:.:..:.:..:.|..|..:.|      :..||:.|                 |.:..|.:.|
  Fly   158 -APKTQAVKAKARTKTHKAEADED------EDAEGEGD-----------------PESRSSNSRE 198

  Fly   269 K----AKRGRMDCEKCG--KVYRNRASYEKHLERE---------C-RRIERR--------VKVDK 309
            .    |..||::|..||  :.:.|.|..::|....         | ||.::|        :..|.
  Fly   199 MDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDP 263

  Fly   310 TTTTCDICNKTLSSATALKLHKEGIHQNVK--PYICDSCGKQLKTITALNEHKLVHTESRPFECT 372
            ....|.||:|.|.|..:..:|....|.|..  .:.||.|.|:......|..|..||.:.|..:|.
  Fly   264 NYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCK 328

  Fly   373 VCKAGFKNRARLKAHYQIHAEPSFV---CNICGKKLQTRRTWNMHK-VVHTEE------------ 421
            .|...|:....|:.|.:...:|:||   |:.||.|.:|::...:|| .||.|.            
  Fly   329 HCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQ 393

  Fly   422 ----------------------RRLKCDVCG----------------------------ALFKRS 436
                                  |:.||:.||                            ..||.|
  Fly   394 VWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSS 458

  Fly   437 KTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNVP 494
            ::|:.|..:|||...|.|.:|.::|..:.|...|:.:.|..:|     |.|..:..||
  Fly   459 RSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMHAAQV-----AALQQQKKVP 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 22/77 (29%)
COG5048 <313..471 CDD:227381 54/225 (24%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 7/20 (35%)
C2H2 Zn finger 426..446 CDD:275368 8/47 (17%)
zf-H2C2_2 439..463 CDD:290200 9/23 (39%)
C2H2 Zn finger 454..475 CDD:275368 5/20 (25%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 22/79 (28%)
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 5/20 (25%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 0/19 (0%)
C2H2 Zn finger 420..440 CDD:275368 3/19 (16%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.