DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG11696

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:603 Identity:140/603 - (23%)
Similarity:224/603 - (37%) Gaps:151/603 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRLCAKDDAHGNVKVQMNENSQGN-WDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELID 74
            ||||.:|..|| |.:...|...|. ....|...|.::..:.:...|.:|:.||..|:..::|:..
  Fly     3 CRLCLEDAEHG-VPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQ 66

  Fly    75 FAEHVTKVQ-----------DIFEVLRRTETD-----GDQEMDVAALRQQFGLCDDDWTHII-KP 122
            |...|.:.|           ::.|:...||.:     .:.|..:.......|  ||...||: :|
  Fly    67 FCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEG--DDIKDHILCEP 129

  Fly   123 -IPALEM--ESDNVYQKPAELLKDFPLAETSSQEMEISK------------RTTTTHLIQTKKNV 172
             |.||..  |.|:.|....|  .||   |..||..|..:            |...|.|.||.:.:
  Fly   130 VIDALSAGDEKDSDYGDTFE--PDF---EPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQII 189

  Fly   173 EMEIPKQEFIDLGPI----LLEKNTSQL--------------------DMEDVLDELPQEELSQP 213
            :.:..|::..:...|    |.|....|.                    |.|||..||..:...||
  Fly   190 KRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQP 254

  Fly   214 RLDSTTSPASMENDVKSEMLDSCEGDDDF--LPVD----GQLMDLV--------AVATTPNTLES 264
            :      |.......|::.|.:.:.:||.  :||.    .::.|.:        |:...|  ||.
  Fly   255 K------PRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAP--LED 311

  Fly   265 TAEEKAK-RGRMDC----EKCGKVYRNRASYEKHLE----------RECRR--IERRVKV----- 307
            ..:.|.. |...||    :.|...|:.|..|..||.          :.||:  :.|..:|     
  Fly   312 FNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLR 376

  Fly   308 -----DKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEH-KLVH-TE 365
                 .:....|.||....:....|.:|.:|.....:|.:||:|.|..:|...|:.| |.:| .:
  Fly   377 FHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAAD 441

  Fly   366 SRPFECTVCKAGFKNRARLKAHYQ-IHAE---PSFVCNICGKKLQTRRTWNMHKVVHTEE----- 421
            ..|..|.:|...|:::|....|.: :|.:   ....|.:||:.|:..|:...|...|.:.     
  Fly   442 FTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTK 506

  Fly   422 --------------------------RRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKS 460
                                      :|.||.:|...||..:.|..|:.:|||:..|.|.:|.::
  Fly   507 YRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRT 571

  Fly   461 FACNANCRSHKLKKHPQE 478
            |..:||..:||.|.||.:
  Fly   572 FKSHANMHNHKKKMHPND 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 21/87 (24%)
COG5048 <313..471 CDD:227381 47/194 (24%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 371..391 CDD:275368 5/20 (25%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 9/23 (39%)
C2H2 Zn finger 454..475 CDD:275368 8/20 (40%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 21/75 (28%)
C2H2 Zn finger 332..349 CDD:275368 6/16 (38%)
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 0/19 (0%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.