DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ace2

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:483 Identity:102/483 - (21%)
Similarity:165/483 - (34%) Gaps:158/483 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DWTHIIK-PIPALEMESDNVYQKPAELLKDFPLAETSSQEMEISKRT---TTTHLIQTKKN---- 171
            |::.::| |...| :|:::.|....::......:..||.:..:|..:   |....|.|::|    
pombe    76 DYSSVLKTPFNPL-LEANSAYFLSNQISLPDSHSYASSFDASLSPPSSPLTCVSQIHTEQNFNNN 139

  Fly   172 --VEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDEL--PQEELSQPRLD---------------- 216
              ..:...:|.|.::|          .|..:.:|||  .|:.||.|..|                
pombe   140 DAFSLTNSQQAFSEIG----------YDASNWIDELDSQQQVLSFPEFDIPEIKTETCSNKDHLE 194

  Fly   217 ----------STTSPASMENDVKSEM---------------LDSCEGDDDFLPVDGQL------- 249
                      .|:.|||......|::               ||...|...|..::.|:       
pombe   195 NFDYLSSSIPETSGPASSVLPSSSQLESFNEFMFLPSSPPGLDEINGAPSFEELNFQISQPSPAH 259

  Fly   250 -MDLVAVATTPN-----------TLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIE 302
             :||.:..|.||           .||.|:.:|..            :...:|: .||: .||..:
pombe   260 PVDLSSPETAPNISPVSPFAQLVKLEPTSPQKPS------------FALDSSF-SHLD-VCRHTD 310

  Fly   303 RR-------------VKVDKTTTTCD--------ICNKTLSSATALKLHKEGIHQNVKPYICDSC 346
            .:             .:.:|.::.||        ..|.||:...||....|......||..|.:.
pombe   311 NQKAFAKLSSPAEYVSEFEKFSSVCDHGLDISNANINNTLTQQFALSAPYESCIVTKKPEPCITV 375

  Fly   347 GKQ-----------LKTITALNEHKLVHTESRP-------FEC-------TVCKAGFKNRARLKA 386
            .::           |.....:.||     :|:|       ..|       .:|:...:..|.|  
pombe   376 KEEEQLAPKIESADLSITPQVTEH-----DSKPPVRISYDHRCKTRKQSTRICRIPPETMASL-- 433

  Fly   387 HYQIHAEPSFVC--NICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGL 449
            :....|:..:||  |.|.|::..:.....|...|..:|..:||:|.|.|.|...||.||..|...
pombe   434 YCGPEADGKYVCLYNGCNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENG 498

  Fly   450 RPYVCNYCGKSFACNANCRSHKLKKHPQ 477
            |||||. |.|.|.     |...|.:|.|
pombe   499 RPYVCE-CLKRFN-----RLDALNRHKQ 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 49/192 (26%)
C2H2 Zn finger 314..335 CDD:275368 8/28 (29%)
C2H2 Zn finger 343..363 CDD:275368 4/30 (13%)
C2H2 Zn finger 371..391 CDD:275368 4/26 (15%)
C2H2 Zn finger 398..418 CDD:275368 5/21 (24%)
C2H2 Zn finger 426..446 CDD:275368 10/19 (53%)
zf-H2C2_2 439..463 CDD:290200 13/23 (57%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)
ace2NP_594109.1 COG5048 45..518 CDD:227381 100/479 (21%)
C2H2 Zn finger 448..467 CDD:275368 4/18 (22%)
zf-C2H2 473..495 CDD:278523 10/21 (48%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..511 CDD:290200 13/29 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.