DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ZNF524

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_011524789.1 Gene:ZNF524 / 147807 HGNCID:28322 Length:370 Species:Homo sapiens


Alignment Length:181 Identity:49/181 - (27%)
Similarity:70/181 - (38%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 TLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARL 384
            |:|..:|  ...||......|:.|..|.:....::.|..|.:.|:|.:|.:|.||...||..:.|
Human   201 TVSEGSA--AGPEGSGPRKAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHL 263

  Fly   385 KAHYQIHAEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGL 449
            :.|          |||                 |...|..:|.:|...|:.:..|..|...|:|.
Human   264 RRH----------CNI-----------------HAGLRPFRCPLCPRRFREAGELAHHHRVHSGE 301

  Fly   450 RPYVCNYCGKSFACNANCRSHKLKKHPQEVQQEDGARL--PSRLNVPTLDE 498
            |||.|..|...|......|.|..:|||:.:    |..|  |...:.|..||
Human   302 RPYQCPICRLRFTEANTLRRHAKRKHPEAM----GVPLCAPDPGSEPPWDE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 39/150 (26%)
C2H2 Zn finger 314..335 CDD:275368 5/14 (36%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 5/20 (25%)
ZNF524XP_011524789.1 COG5048 <219..>283 CDD:227381 22/90 (24%)
C2H2 Zn finger 222..242 CDD:275368 4/19 (21%)
zf-H2C2_2 234..259 CDD:290200 9/24 (38%)
C2H2 Zn finger 250..270 CDD:275368 10/46 (22%)
zf-H2C2_2 262..285 CDD:290200 9/49 (18%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-H2C2_2 290..314 CDD:290200 9/23 (39%)
C2H2 Zn finger 306..327 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.