Sequence 1: | NP_609951.2 | Gene: | CG17568 / 35198 | FlyBaseID: | FBgn0032763 | Length: | 513 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060553.4 | Gene: | ZNF358 / 140467 | HGNCID: | 16838 | Length: | 568 | Species: | Homo sapiens |
Alignment Length: | 322 | Identity: | 92/322 - (28%) |
---|---|---|---|
Similarity: | 133/322 - (41%) | Gaps: | 36/322 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 EIPKQEFIDLGPILLEKNTSQLDMEDVLDEL------PQEELSQPRLDSTTSPASMENDV----- 228
Fly 229 -----KSEMLDSCEGDDDFLPVDGQLMDLVAV-ATTPNTLESTAEEKAKRGRMDCEKCGKVYRNR 287
Fly 288 ASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKT 352
Fly 353 ITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIHAEP-SFVCNICGKKLQTRRTWNMHKV 416
Fly 417 VHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKHPQE 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17568 | NP_609951.2 | zf-AD | 10..87 | CDD:214871 | |
COG5048 | <313..471 | CDD:227381 | 53/158 (34%) | ||
C2H2 Zn finger | 314..335 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 439..463 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 454..475 | CDD:275368 | 8/20 (40%) | ||
ZNF358 | NP_060553.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..117 | 18/79 (23%) | |
COG5048 | <35..339 | CDD:227381 | 89/315 (28%) | ||
lambda-1 | 108..>174 | CDD:212564 | 19/79 (24%) | ||
zf-C2H2 | 151..173 | CDD:278523 | 7/30 (23%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 7/28 (25%) | ||
zf-H2C2_2 | 166..190 | CDD:290200 | 6/32 (19%) | ||
C2H2 Zn finger | 181..201 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 194..216 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 222..244 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 250..272 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 265..285 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 277..300 | CDD:290200 | 8/22 (36%) | ||
zf-C2H2_8 | 292..370 | CDD:292531 | 22/54 (41%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 305..328 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 321..341 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 333..356 | CDD:290200 | 5/13 (38%) | ||
C2H2 Zn finger | 349..369 | CDD:275368 | |||
zf-H2C2_2 | 361..384 | CDD:290200 | |||
zf-C2H2 | 375..397 | CDD:278523 | |||
C2H2 Zn finger | 377..397 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 448..568 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |