DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and PSH1

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_014587.1 Gene:PSH1 / 854102 SGDID:S000005415 Length:406 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:23/120 - (19%)
Similarity:45/120 - (37%) Gaps:26/120 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QSYLCANCVTAHEFMH------CFNGHNVC--LIKGFEASTTGTPLSVGSPSNNPASNEFKYASS 253
            :|.:|:.|   |::|.      |  |||.|  .:..:.||.|...|:...     ..::.....:
Yeast    26 ESLVCSIC---HDYMFVPMMTPC--GHNYCYGCLNTWFASNTQKELACPQ-----CRSDITTIPA 80

  Fly   254 LTMMLQQQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQEQQRE-DSIY 307
            |...|||......::.:.|..       ....|::.....:.|..:..:| |:::
Yeast    81 LNTTLQQYLSFILEKLRDQND-------ESFKKLLTTKTKEENDYKNDKEKDTLF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662 10/32 (31%)
zf-B_box 328..366 CDD:279037
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
PSH1NP_014587.1 RING-HC_ScPSH1_like 29..72 CDD:319482 13/52 (25%)
DNA_RNApol_7kD 149..>175 CDD:412622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2677
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.