DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and AT4G01350

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_192044.2 Gene:AT4G01350 / 828015 AraportID:AT4G01350 Length:652 Species:Arabidopsis thaliana


Alignment Length:76 Identity:22/76 - (28%)
Similarity:30/76 - (39%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 CTACKSKCSDAVAKCFECQSYLCANCV-TAHEFMH-CFNGHNVCLIKGFEASTTGTPLSVGSPSN 241
            |..||...:.....|.||..|...||: .:.|..| |.:.|.:.||. ||:.|.....:......
plant   138 CELCKDSIAGPSYSCLECDVYFHVNCIQLSKEVNHPCHSAHPLKLIP-FESLTDDAETTCLLCGK 201

  Fly   242 NPASNEFKYAS 252
            .||.|...:.|
plant   202 KPAENMLYHCS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662 13/44 (30%)
zf-B_box 328..366 CDD:279037
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
AT4G01350NP_192044.2 C1_3 391..420 CDD:284959
C1_2 551..581 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.