DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment brat and RNF208

DIOPT Version :9

Sequence 1:	NP_001188842.2	Gene:	brat / 35197	FlyBaseID:	FBgn0010300	Length:	1061	Species:	Drosophila melanogaster
Sequence 2:	NP_001375226.1	Gene:	RNF208 / 727800	HGNCID:	25420	Length:	261	Species:	Homo sapiens

Alignment Length:	62	Identity:	14/62 - (22%)
Similarity:	27/62 - (43%)	Gaps:	15/62 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   164 NSSSSNTSANGSPPRCTACKS------------KCSDAVAKCFECQSYLCANCVTAHEFMHC 213
            ::|:::::|.|.|..|..|..            .|..:|  |.:|...|..:| ..::|:.|
Human   128 SASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSV--CEQCLQILYESC-PKYKFISC 186

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
brat	NP_001188842.2	BBOX	176..222	CDD:197662	11/50 (22%)
		zf-B_box	328..366	CDD:279037
		NHL_brat_like	760..1030	CDD:271329
		NHL repeat	783..819	CDD:271329
		NHL repeat	830..871	CDD:271329
		NHL repeat	874..910	CDD:271329
		NHL repeat	914..954	CDD:271329
		NHL repeat	959..997	CDD:271329
		NHL repeat	1002..1027	CDD:271329
RNF208	NP_001375226.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	83..106
RNF208	NP_001375226.1	RING-HC_RNF208	140..193	CDD:319473	11/50 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D489543at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010