DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and Rnf208

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_789804.2 Gene:Rnf208 / 68846 MGIID:1916096 Length:265 Species:Mus musculus


Alignment Length:259 Identity:50/259 - (19%)
Similarity:72/259 - (27%) Gaps:91/259 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASSPTPSLDSMRGGANSIESYEHAGYLSDSPLTLSGSS--PPASDSAICSDEYTGGSSVKSRSEV 64
            |..|||:|...|...:..|...:.....|.| ||.|:|  ||............|...|....||
Mouse    54 APRPTPTLAPKRAWPSDTEIIVNQACGGDMP-TLEGASHTPPLPRRPRKGSSELGFPRVAPVDEV 117

  Fly    65 TVINGH--HPISASVSSSSSASSSSCSSSSSSSSSSSSSSSSTSGLSGCGSTSSSVISANNVASS 127
             ::|.:  .|                                       |.|:|:       .||
Mouse   118 -IVNQYVIRP---------------------------------------GPTASA-------PSS 135

  Fly   128 NGPGVIGSNLQSSNNGGNSGISSLVVGAGKGSNSSSNSSSSNTSANGSPPRCTAC-KSKCSDAVA 191
            :||.:.|..|:....|....::.                        ..||..:| .|.|...:.
Mouse   136 SGPVIAGEPLECPTCGHTYNVTQ------------------------RRPRVLSCLHSVCEQCLQ 176

  Fly   192 KCFE-CQSYLCANCVTAHEFMHCFNGHNVCLIKGFEASTTGT-------PLSVGSPSNNPASNE 247
            ..:| |..|...:|.|.|.....|..:      |..|....|       |.::.:||......|
Mouse   177 ILYESCPKYKFISCPTCHRETVLFTDY------GLAALAVNTSILSRLPPEALTAPSGGQWGGE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662 12/47 (26%)
zf-B_box 328..366 CDD:279037
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
Rnf208NP_789804.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..106 7/23 (30%)
RING-HC_RNF208 144..197 CDD:319473 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.