DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and trim45

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001011026.1 Gene:trim45 / 496435 XenbaseID:XB-GENE-997848 Length:547 Species:Xenopus tropicalis


Alignment Length:557 Identity:103/557 - (18%)
Similarity:170/557 - (30%) Gaps:178/557 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SSSNTSANGSPPRCTACKSK-CSDAVAKCFECQSYLCANCVTAHE-FMHCFNGHNVCLIKGFEAS 228
            :.|...|.|. .:|..|:.. |...:..|...   ||..|:...| |.....||           
 Frog     4 NGSRKEAQGR-TQCPQCQQPFCQPRILPCLHT---LCGGCLAKLEPFSALGKGH----------- 53

  Fly   229 TTGTPLSVGSPSNN-----PASNEFK----YASSLTMMLQQQQQ------LDSQQQQQQQQLLPA 278
            :.||..||..|..:     ||....:    :.:...::|.|.|.      .|..::.|      |
 Frog    54 SAGTHWSVLCPVCDSEVALPAGGVEELLPDWLAEAEVLLAQVQSGGLALPCDLCREGQ------A 112

  Fly   279 QPMSQLSKI-VLAAAAQANSQEQQREDSIYGSLHPQQQQQQQQQQQRQLFCPRHKQELLKFSCRT 342
            :...|..|: |.....||:.::::   :....|||.|.............|..|..|.|...|..
 Frog   113 EKRCQECKVNVCEFCCQAHRRQKR---TAAHPLHPLQDLSLGTILPPAPCCTLHPLEALGLFCEP 174

  Fly   343 CCILVCKECIVLEHSTGLHELENVQSPGMTTSTGSTANESALQTL------LADMRGKIGEI--- 398
            |.:..|::|.:..|..  |:|.    |....:.|.  .||.|:.|      :..:...:|.:   
 Frog   175 CTVPCCRDCAIGHHRG--HDLR----PAAECAGGH--RESLLRALQEAEPHIEQLEAALGGVQEA 231

  Fly   399 --------VGIAGNSD---QNLTKVKLQYQKA-HNELNETHQFFASMLDERKTELLKELETLYTA 451
                    :|:....:   :...:..|:::.| ..::.|..|....:|..||.:|.::|..|.||
 Frog   232 GKALGQRALGLRAEVEAFIEGYVRAVLEHKAALLRDIEEETQRRQQVLALRKAQLQQQLLDLRTA 296

  Fly   452 K------------------------------------VNSNN-------SWQQRSR--------- 464
            .                                    .:.||       .|::...         
 Frog   297 SGFTRDLVARGPDLHLLQAQGLALTRLKELNQGAPRAADQNNPAGIQFSPWEEAGLCQGYQMQGV 361

  Fly   465 ---DLIDKGLATCEA--------VERSPA------------------PPSSLLTEALLLRKSLEQ 500
               ...|.|  .|||        .:..||                  |||     ..::.|..::
 Frog   362 LQVKAADPG--KCEARGAGLQSVCQGQPASFTFFCRTASGDPVLGGQPPS-----VTIVHKDTDR 419

  Fly   501 QLQTGIQEMQLPFEIEFMSNYQSIQAGVRNTFGYIRANSSDGGPTGMSLTSNGHGKQPPIARPTQ 565
            .|...||:.|   :..|..:|.:.:.|..:....:|...:.|.|..:.:..... :.|.|.....
 Frog   420 SLHPSIQDNQ---DGTFHISYLAPEPGELSISVSLRGQHTPGSPFSVKVRGKSQ-RHPGIYHCCT 480

  Fly   566 SASNSSASSA---------------GSGHHGHHQQSH 587
            ..|:.....|               |.||.||..|||
 Frog   481 FCSSGGQKEARCGCGGTMPGGYQGCGHGHKGHPGQSH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662 11/47 (23%)
zf-B_box 328..366 CDD:279037 11/37 (30%)
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
trim45NP_001011026.1 RING-HC_TRIM45-C-VII 14..69 CDD:319502 16/68 (24%)
Bbox1_TRIM45_C-X 102..145 CDD:380867 10/51 (20%)
zf-B_box 155..195 CDD:395518 11/45 (24%)
BBC 203..>279 CDD:128778 10/77 (13%)
Filamin 366..461 CDD:395505 20/104 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.