| Sequence 1: | NP_001188842.2 | Gene: | brat / 35197 | FlyBaseID: | FBgn0010300 | Length: | 1061 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001012772.1 | Gene: | NHLRC3 / 387921 | HGNCID: | 33751 | Length: | 347 | Species: | Homo sapiens |
| Alignment Length: | 261 | Identity: | 55/261 - (21%) |
|---|---|---|---|
| Similarity: | 83/261 - (31%) | Gaps: | 102/261 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 656 FGELMPKRGGGGYTGSNGSATSAVAHYNPYEKWSNGGSDNLFSSVTSGVSGSSAVADAFASLSAV 720
Fly 721 GGSVVSGAGAGGSTVSSESLLDLTNKLLSATIYPPKSQIKRQKMIYHCKFGEFGVMEGQFTEPSG 785
Fly 786 VAVNAQNDIIVADTNNHRIQIFDK---------------EGRFKFQF------------------ 817
Fly 818 ----------GECG-----KRDSQLLYPNRVAVVRNSGDIIVTERSPTHQIQIYNQYGQFVRKFG 867
Fly 868 A 868 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| brat | NP_001188842.2 | BBOX | 176..222 | CDD:197662 | |
| zf-B_box | 328..366 | CDD:279037 | |||
| NHL_brat_like | 760..1030 | CDD:271329 | 37/157 (24%) | ||
| NHL repeat | 783..819 | CDD:271329 | 15/78 (19%) | ||
| NHL repeat | 830..871 | CDD:271329 | 12/39 (31%) | ||
| NHL repeat | 874..910 | CDD:271329 | |||
| NHL repeat | 914..954 | CDD:271329 | |||
| NHL repeat | 959..997 | CDD:271329 | |||
| NHL repeat | 1002..1027 | CDD:271329 | |||
| NHLRC3 | NP_001012772.1 | NHL 1 | 47..93 | ||
| NHL | 66..336 | CDD:302697 | 51/248 (21%) | ||
| NHL repeat | 107..153 | CDD:271320 | 4/14 (29%) | ||
| NHL 2 | 150..196 | 14/94 (15%) | |||
| NHL repeat | 166..205 | CDD:271320 | 12/87 (14%) | ||
| NHL 3 | 200..243 | 15/42 (36%) | |||
| NHL repeat | 213..250 | CDD:271320 | 13/36 (36%) | ||
| NHL repeat | 258..295 | CDD:271320 | 3/36 (8%) | ||
| NHL 4 | 294..338 | 14/45 (31%) | |||
| NHL repeat | 308..335 | CDD:271320 | 9/28 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D489543at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||