DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and NHLRC1

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_940988.2 Gene:NHLRC1 / 378884 HGNCID:21576 Length:395 Species:Homo sapiens


Alignment Length:293 Identity:66/293 - (22%)
Similarity:115/293 - (39%) Gaps:49/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   767 HCKFGEFGVMEGQFTEPSGVAVNAQND-IIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYP 830
            |..||.:|.:    ..|:|:|:..:.. ::|......|::|||..|....||||.|.....:.||
Human   117 HHTFGGWGTL----VNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYP 177

  Fly   831 NRVAVVRNSGDIIVTERSPTHQIQIYNQYGQFVRKFGATILQHPRGVTVDNKGRIIVVECKVMRV 895
            ..|.:. |...::||: :....|::::.:||.....|.. ...|.||....:..|:|.:.:...:
Human   178 VDVTIT-NDCHVVVTD-AGDRSIKVFDFFGQIKLVIGGQ-FSLPWGVETTPQNGIVVTDAEAGSL 239

  Fly   896 IIFD---QNGNVLHKFGCSKHLEFPNGVVVN------DKQEIFISDNRAHC---VKVFNYEGQYL 948
            .:.|   ..|.:........||..|.||.|:      ...|..::.....|   ||||:...|.:
Human   240 HLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSSMQLV 304

  Fly   949 RQIGGEGITNY------PIGVGINSNGEILIADNHNNFNLTIFTQDGQLISAL---------ESK 998
            .|:...|::.|      ...|..:..|.:::||.           .|..|..|         :..
Human   305 GQVDTFGLSLYFPSKITASAVTFDHQGNVIVADT-----------SGPAILCLGKPEEFPVPKPM 358

  Fly   999 VKHAQCFDVAL---MDDGSVVLASKDYRLYIYR 1028
            |.|.....|||   .::..:||.:..:.:.:|:
Human   359 VTHGLSHPVALTFTKENSLLVLDTASHSIKVYK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662
zf-B_box 328..366 CDD:279037
NHL_brat_like 760..1030 CDD:271329 66/293 (23%)
NHL repeat 783..819 CDD:271329 11/36 (31%)
NHL repeat 830..871 CDD:271329 9/40 (23%)
NHL repeat 874..910 CDD:271329 7/38 (18%)
NHL repeat 914..954 CDD:271329 13/48 (27%)
NHL repeat 959..997 CDD:271329 8/52 (15%)
NHL repeat 1002..1027 CDD:271329 5/27 (19%)
NHLRC1NP_940988.2 RING-HC_malin 25..72 CDD:319430
RING-HC finger (C3HC4-type) 26..71 CDD:319430
HemN 53..>133 CDD:333012 6/19 (32%)
NHL 1 113..157 12/43 (28%)
NHL_TRIM32_like 118..391 CDD:271331 64/290 (22%)
NHL repeat 129..169 CDD:271331 13/39 (33%)
NHL 2 161..204 12/44 (27%)
NHL repeat 177..216 CDD:271331 9/41 (22%)
NHL 3 205..245 9/40 (23%)
NHL repeat 218..259 CDD:271331 7/40 (18%)
NHL 4 248..300 13/51 (25%)
NHL repeat 261..313 CDD:271331 14/51 (27%)
NHL 5 301..349 11/58 (19%)
NHL repeat 321..353 CDD:271331 7/42 (17%)
NHL 6 350..393 8/42 (19%)
NHL repeat 364..390 CDD:271331 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.