DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and Rnf152

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001099775.1 Gene:Rnf152 / 293561 RGDID:1305251 Length:203 Species:Rattus norvegicus


Alignment Length:204 Identity:39/204 - (19%)
Similarity:71/204 - (34%) Gaps:51/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KCFECQSYLCANCV----TAHEFMHCFNGHNVC-LIKGFEAS-----------------TTGTPL 234
            |..:|:...|:.|:    |:.:.:.|.....:. |..||..|                 :..||:
  Rat    26 KLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPV 90

  Fly   235 SVGSPSNNPASNEFKYASSLTMMLQQQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQE 299
            .:..|||.        ...|.:.:.:::.|  .......:|||......|:.:.:.|       |
  Rat    91 FIKLPSNG--------CYMLPLPISKERTL--LPGDMGCRLLPGSQQKSLTVVTIPA-------E 138

  Fly   300 QQREDSIYGSLHPQQQQQQQQQQQRQLFCPRHKQELLKFSCR---TCCILVCKECIVLEHSTGLH 361
            ||   .:.|.. ||:..:::..::...     |.......|.   ..|:||....|||.:.:.:.
  Rat   139 QQ---PLQGGA-PQEAVEEEPDRRGVA-----KSSTWSGVCTVILVACVLVFLLGIVLHNMSCIS 194

  Fly   362 ELENVQSPG 370
            :...|.|.|
  Rat   195 KRFTVISCG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662 6/34 (18%)
zf-B_box 328..366 CDD:279037 8/40 (20%)
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
Rnf152NP_001099775.1 RING-HC_RNF152 11..55 CDD:319462 6/28 (21%)
Necessary for interaction with RRAGA. /evidence=ECO:0000250|UniProtKB:Q8N8N0 106..165 13/76 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..159 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.