Sequence 1: | NP_001188842.2 | Gene: | brat / 35197 | FlyBaseID: | FBgn0010300 | Length: | 1061 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099775.1 | Gene: | Rnf152 / 293561 | RGDID: | 1305251 | Length: | 203 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 39/204 - (19%) |
---|---|---|---|
Similarity: | 71/204 - (34%) | Gaps: | 51/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 KCFECQSYLCANCV----TAHEFMHCFNGHNVC-LIKGFEAS-----------------TTGTPL 234
Fly 235 SVGSPSNNPASNEFKYASSLTMMLQQQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQE 299
Fly 300 QQREDSIYGSLHPQQQQQQQQQQQRQLFCPRHKQELLKFSCR---TCCILVCKECIVLEHSTGLH 361
Fly 362 ELENVQSPG 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
brat | NP_001188842.2 | BBOX | 176..222 | CDD:197662 | 6/34 (18%) |
zf-B_box | 328..366 | CDD:279037 | 8/40 (20%) | ||
NHL_brat_like | 760..1030 | CDD:271329 | |||
NHL repeat | 783..819 | CDD:271329 | |||
NHL repeat | 830..871 | CDD:271329 | |||
NHL repeat | 874..910 | CDD:271329 | |||
NHL repeat | 914..954 | CDD:271329 | |||
NHL repeat | 959..997 | CDD:271329 | |||
NHL repeat | 1002..1027 | CDD:271329 | |||
Rnf152 | NP_001099775.1 | RING-HC_RNF152 | 11..55 | CDD:319462 | 6/28 (21%) |
Necessary for interaction with RRAGA. /evidence=ECO:0000250|UniProtKB:Q8N8N0 | 106..165 | 13/76 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 140..159 | 4/22 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D489543at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |