DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and Nhlrc3

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_766089.1 Gene:Nhlrc3 / 212114 MGIID:2444520 Length:347 Species:Mus musculus


Alignment Length:264 Identity:51/264 - (19%)
Similarity:102/264 - (38%) Gaps:80/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   867 GATILQHPRGVTVDNKGRIIVVECK---VMRVIIFDQNGNVLHKFGCSKHLEFPNGVVVND---K 925
            |||..     |.||:...::.|..:   :.:|::|.::|..|..:..:  ::.|:|:.|:.   :
Mouse    61 GATFC-----VAVDSLNGLVYVAQRGDNIPKVLVFSEDGYFLRAWNYT--VDTPHGMFVSGTPFE 118

  Fly   926 QEIFISD----NRAHCVKVFNYEGQYLRQIG-----GEGIT----NYPIGVGINSNGEILIADNH 977
            |.::|:|    ...|.||.:|..|..::.:|     |.|:.    :.|..:.::..||:.|.|..
Mouse   119 QSVWITDVGSGPYGHTVKKYNSLGDLVQVLGTPGKKGTGLNPLQFDNPAELYVDDTGEMYIVDGD 183

  Fly   978 NNFN--LTIFTQDGQLI--------SALESKVKHAQCFDVALMDDGSVVLASK-DYRLYIY---- 1027
            ...|  |...:||..::        ...:..:.|:...|..    |.|.:|.: :.||.::    
Mouse   184 GGLNNRLVKLSQDFMILWLRGENGTGPAKFNIPHSVTLDAV----GRVWVADRGNKRLQVFDKDT 244

  Fly  1028 -------------------------RYVQLAPVVLHKLHSNINETSKSF----------LADRIQ 1057
                                     :|:.:|.:.|.:|...:...|.|.          |||::.
Mouse   245 GEWLGAWDNCFTEEGPSAVRFTPDGKYLIVAQLNLSRLSVLLAPPSGSIGDCSVVSTIQLADQVL 309

  Fly  1058 QHFI 1061
            .|.:
Mouse   310 PHLL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662
zf-B_box 328..366 CDD:279037
NHL_brat_like 760..1030 CDD:271329 41/221 (19%)
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329 3/3 (100%)
NHL repeat 874..910 CDD:271329 8/38 (21%)
NHL repeat 914..954 CDD:271329 12/51 (24%)
NHL repeat 959..997 CDD:271329 9/47 (19%)
NHL repeat 1002..1027 CDD:271329 6/25 (24%)
Nhlrc3NP_766089.1 NHL 1 47..93 9/36 (25%)
NHL 66..336 CDD:302697 48/254 (19%)
YncE <66..308 CDD:225926 47/247 (19%)
NHL repeat 107..153 CDD:271320 12/45 (27%)
NHL 2 150..196 9/45 (20%)
NHL repeat 166..205 CDD:271320 9/38 (24%)
NHL 3 200..243 7/46 (15%)
NHL repeat 213..250 CDD:271320 7/40 (18%)
NHL repeat 258..299 CDD:271320 6/40 (15%)
NHL 4 294..338 4/20 (20%)
NHL repeat 308..335 CDD:271320 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.