Sequence 1: | NP_001188842.2 | Gene: | brat / 35197 | FlyBaseID: | FBgn0010300 | Length: | 1061 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496523.1 | Gene: | F43G6.8 / 174815 | WormBaseID: | WBGene00009660 | Length: | 263 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 35/204 - (17%) |
---|---|---|---|
Similarity: | 74/204 - (36%) | Gaps: | 75/204 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 260 QQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQEQQREDSIYGS--LHPQQQQQQQQQQ 322
Fly 323 QRQLFCPRHKQELLKFSCRTCCILVCKECIVLEHSTGLHELENV-------------------QS 368
Fly 369 PGMTTSTGSTANESALQTLL-------ADMRGKIGEIVGIAGNSDQNLTKVKLQ------YQKAH 420
Fly 421 NELNETHQF 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
brat | NP_001188842.2 | BBOX | 176..222 | CDD:197662 | |
zf-B_box | 328..366 | CDD:279037 | 4/37 (11%) | ||
NHL_brat_like | 760..1030 | CDD:271329 | |||
NHL repeat | 783..819 | CDD:271329 | |||
NHL repeat | 830..871 | CDD:271329 | |||
NHL repeat | 874..910 | CDD:271329 | |||
NHL repeat | 914..954 | CDD:271329 | |||
NHL repeat | 959..997 | CDD:271329 | |||
NHL repeat | 1002..1027 | CDD:271329 | |||
F43G6.8 | NP_496523.1 | SMC_prok_B | <15..>188 | CDD:274008 | 35/204 (17%) |
RING-HC_TRIM32_C-VII | 198..243 | CDD:319501 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D489543at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |