DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brat and F43G6.8

DIOPT Version :9

Sequence 1:NP_001188842.2 Gene:brat / 35197 FlyBaseID:FBgn0010300 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_496523.1 Gene:F43G6.8 / 174815 WormBaseID:WBGene00009660 Length:263 Species:Caenorhabditis elegans


Alignment Length:204 Identity:35/204 - (17%)
Similarity:74/204 - (36%) Gaps:75/204 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 QQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQEQQREDSIYGS--LHPQQQQQQQQQQ 322
            :::::..::||.|:       :..|.:.:        .:.:||||....:  ||....:.:||:.
 Worm    22 KRERISVEEQQSQE-------IRNLKRKL--------EEARQREDKYIKNEQLHHTAMRSKQQRI 71

  Fly   323 QRQLFCPRHKQELLKFSCRTCCILVCKECIVLEHSTGLHELENV-------------------QS 368
            :|.       ::.::.:.|......|:          |:::||:                   .|
 Worm    72 ERM-------EKSMESTNRKMYATQCR----------LNDMENIYDDLEMESKIMADFIDHYYDS 119

  Fly   369 PGMTTSTGSTANESALQTLL-------ADMRGKIGEIVGIAGNSDQNLTKVKLQ------YQKAH 420
            ..:|..     :...||..|       .|:..:|.|:    .:.|:.:..|:.:      |:|..
 Worm   120 RNITEE-----DRDELQDKLDEEAANYRDLEDRIKEV----RHRDRYMKTVETERKRTTFYRKKM 175

  Fly   421 NELNETHQF 429
            .||.|..||
 Worm   176 LELAEQLQF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bratNP_001188842.2 BBOX 176..222 CDD:197662
zf-B_box 328..366 CDD:279037 4/37 (11%)
NHL_brat_like 760..1030 CDD:271329
NHL repeat 783..819 CDD:271329
NHL repeat 830..871 CDD:271329
NHL repeat 874..910 CDD:271329
NHL repeat 914..954 CDD:271329
NHL repeat 959..997 CDD:271329
NHL repeat 1002..1027 CDD:271329
F43G6.8NP_496523.1 SMC_prok_B <15..>188 CDD:274008 35/204 (17%)
RING-HC_TRIM32_C-VII 198..243 CDD:319501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.