DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1D and RPB11

DIOPT Version :10

Sequence 1:NP_001260563.1 Gene:Polr1D / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_014638.1 Gene:RPB11 / 854157 SGDID:S000005365 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:43 Identity:15/43 - (34%)
Similarity:22/43 - (51%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQS 91
            |..|.|||||.::..:....:|.|..|.:.||...:...|||:
Yeast    35 FEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQT 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1DNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 15/43 (35%)
RPB11NP_014638.1 RNAP_II_RPB11 13..105 CDD:132902 15/43 (35%)

Return to query results.
Submit another query.