DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and RPC14

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001077977.1 Gene:RPC14 / 817503 AraportID:AT2G29540 Length:139 Species:Arabidopsis thaliana


Alignment Length:87 Identity:23/87 - (26%)
Similarity:39/87 - (44%) Gaps:22/87 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAE-------- 124
            |.|....||||||:.::::.|:|:..|.|.::.|...::|..:..|....|:|.:||        
plant    52 PRVTVAAYTIPHPSLEQVNIRVQTTGDPAREVFKDACQELMQMNRHVRSVFDKAVAEYKDEQKRK 116

  Fly   125 --------------FNAMKVEN 132
                          |.:|.:||
plant   117 EEAEEEELKRQRDLFGSMDIEN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 15/49 (31%)
RNA_pol_L 46..>80 CDD:279526 6/11 (55%)
RPC14NP_001077977.1 RNAP_RPB11_RPB3 <52..102 CDD:299707 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102491
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.