powered by:
Protein Alignment l(2)37Cg and polr2j
DIOPT Version :9
Sequence 1: | NP_001260563.1 |
Gene: | l(2)37Cg / 35196 |
FlyBaseID: | FBgn0086447 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001039095.1 |
Gene: | polr2j / 733914 |
XenbaseID: | XB-GENE-972012 |
Length: | 117 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 20/48 - (41%) |
Similarity: | 30/48 - (62%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 FVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD 94
|....|.||:||.:|:.:.:.|:|.|.||.:|||.|.|:..|:|:..|
Frog 33 FTINKEDHTIGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1398114at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.