DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and polr1d

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001003888.1 Gene:polr1d / 445412 ZFINID:ZDB-GENE-040930-4 Length:112 Species:Danio rerio


Alignment Length:85 Identity:41/85 - (48%)
Similarity:57/85 - (67%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EGSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLE 105
            ||..|||...|.|||||:|:.:|.:..:|:||||:|.||:|.|::||||:|.. .|.:.|:.||.
Zfish    20 EGCVTFVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQTRDGVPASEPLRNGLN 84

  Fly   106 DLEGLCDHTIVTFEKEMAEF 125
            :|..:|.|.:.|||..|.||
Zfish    85 NLTDVCKHVLQTFEARMKEF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 35/76 (46%)
RNA_pol_L 46..>80 CDD:279526 17/33 (52%)
polr1dNP_001003888.1 RNAP_I_III_AC19 13..97 CDD:132907 35/76 (46%)
RNA_pol_L 24..>55 CDD:279526 16/30 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590169
Domainoid 1 1.000 71 1.000 Domainoid score I9399
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22239
Inparanoid 1 1.050 85 1.000 Inparanoid score I5149
OMA 1 1.010 - - QHG53905
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 1 1.000 - - otm26581
orthoMCL 1 0.900 - - OOG6_102491
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1181
SonicParanoid 1 1.000 - - X3912
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.