DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1D and Polr2J

DIOPT Version :10

Sequence 1:NP_001260563.1 Gene:Polr1D / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_609836.1 Gene:Polr2J / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster


Alignment Length:48 Identity:21/48 - (43%)
Similarity:27/48 - (56%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD 94
            |....|.|||||.::..:.:.|.|.|.||.:|||.|.|...|||:..|
  Fly    33 FTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQTTAD 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1DNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 21/48 (44%)
Polr2JNP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 21/48 (44%)

Return to query results.
Submit another query.