DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and rpc19

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_593118.2 Gene:rpc19 / 2542799 PomBaseID:SPAC1687.01 Length:125 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:40/89 - (44%)
Similarity:60/89 - (67%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSR-RDRAIDILKRGLEDL 107
            |.||....|.|||||:|:.:|.:.|||:||||:||||:|.|::||||:. ...|:|:|::||:||
pombe    34 SVTFQIQKEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDL 98

  Fly   108 EGLCDHTIVTFEKEMAEFNAMKVE 131
            ..|||.....|.:::....:..:|
pombe    99 IDLCDAVTEKFTEQLPRDTSTTME 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 38/74 (51%)
RNA_pol_L 46..>80 CDD:279526 19/33 (58%)
rpc19NP_593118.2 RNAP_I_III_AC19 25..109 CDD:132907 38/74 (51%)
RNA_pol_L 36..102 CDD:279526 34/65 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 83 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22239
Inparanoid 1 1.050 86 1.000 Inparanoid score I1792
OMA 1 1.010 - - QHG53905
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 1 1.000 - - oto101839
orthoMCL 1 0.900 - - OOG6_102491
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1181
SonicParanoid 1 1.000 - - X3912
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.