DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and Polr1d

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_033113.1 Gene:Polr1d / 20018 MGIID:108403 Length:133 Species:Mus musculus


Alignment Length:85 Identity:39/85 - (45%)
Similarity:56/85 - (65%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDLEG 109
            |||...|.|||||.|:.||.:.|||:|||||..||:|.|::.|||:|.. .|::..::||.:|..
Mouse    41 TFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLN 105

  Fly   110 LCDHTIVTFEKEMAEFNAMK 129
            :|.|.:|.||..:.::.|.|
Mouse   106 VCQHVLVKFEASIKDYKAKK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 35/72 (49%)
RNA_pol_L 46..>80 CDD:279526 20/33 (61%)
Polr1dNP_033113.1 RNAP_I_III_AC19 30..114 CDD:132907 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845569
Domainoid 1 1.000 73 1.000 Domainoid score I9230
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22239
Inparanoid 1 1.050 84 1.000 Inparanoid score I5169
Isobase 1 0.950 - 0 Normalized mean entropy S862
OMA 1 1.010 - - QHG53905
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 1 1.000 - - oto94706
orthoMCL 1 0.900 - - OOG6_102491
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1181
SonicParanoid 1 1.000 - - X3912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.