DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and rpac-19

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_499132.1 Gene:rpac-19 / 176362 WormBaseID:WBGene00010230 Length:144 Species:Caenorhabditis elegans


Alignment Length:76 Identity:30/76 - (39%)
Similarity:49/76 - (64%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DEKNGE---GSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAI 97
            |.|:.|   .:.|.:...|.||:||::|.|::|..||:||||.:|||.|.|:.||:|::.. .|:
 Worm    50 DPKSFEQDPSNLTLIMYEEDHTIGNSIKHILSRMDEVEFCGYNVPHPLEDKILFRVQTKDGINAL 114

  Fly    98 DILKRGLEDLE 108
            ::|.:..|.:|
 Worm   115 EVLAKAFESVE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 30/76 (39%)
RNA_pol_L 46..>80 CDD:279526 16/33 (48%)
rpac-19NP_499132.1 RNAP_I_III_AC19 52..135 CDD:132907 29/74 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163735
Domainoid 1 1.000 66 1.000 Domainoid score I6584
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S862
OMA 1 1.010 - - QHG53905
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 1 1.000 - - oto17859
orthoMCL 1 0.900 - - OOG6_102491
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1181
SonicParanoid 1 1.000 - - X3912
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.740

Return to query results.
Submit another query.