DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and rpb-11

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_496942.1 Gene:rpb-11 / 175056 WormBaseID:WBGene00012187 Length:122 Species:Caenorhabditis elegans


Alignment Length:84 Identity:34/84 - (40%)
Similarity:44/84 - (52%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EKNGEGSRTFVFT--NEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRA-IDI 99
            ||:.:.....:||  .|.|||||.||..:.:.|||.|.||..|||.|.|:..|||:..:.. .|.
 Worm    21 EKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGYKNPHPLEHKILLRIQTTNNTTPADA 85

  Fly   100 LKRGLEDLEG---LCDHTI 115
            |...:.||.|   |.:|.|
 Worm    86 LTTAITDLVGELSLLEHRI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 34/84 (40%)
RNA_pol_L 46..>80 CDD:279526 17/35 (49%)
rpb-11NP_496942.1 RNAP_II_RPB11 14..103 CDD:132902 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.