DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1D and Rpb11

DIOPT Version :10

Sequence 1:NP_001260563.1 Gene:Polr1D / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_319985.2 Gene:Rpb11 / 1280168 VectorBaseID:AGAMI1_005757 Length:117 Species:Anopheles gambiae


Alignment Length:84 Identity:29/84 - (34%)
Similarity:43/84 - (51%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRA-IDILKRGLEDLEGL 110
            |....|.|||||.::..:.:.|.|.|.||.:|||.|.|...|||:..:.: .:.....:.||  |
Mosquito    33 FTVNKEDHTLGNMIRNQLLKDPNVLFAGYKLPHPLEHKFVLRIQTTSEYSPHEAFMNAITDL--L 95

  Fly   111 CDHTIVTFEKEMAEFNAMK 129
            .:.::  ||:...|  |||
Mosquito    96 SELSL--FEERFRE--AMK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1DNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 23/71 (32%)
Rpb11XP_319985.2 RNAP_II_RPB11 14..105 CDD:132902 25/75 (33%)

Return to query results.
Submit another query.