powered by:
Protein Alignment l(2)37Cg and polr1d.2
DIOPT Version :9
Sequence 1: | NP_001260563.1 |
Gene: | l(2)37Cg / 35196 |
FlyBaseID: | FBgn0086447 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017952449.1 |
Gene: | polr1d.2 / 100495369 |
XenbaseID: | XB-GENE-5852282 |
Length: | 140 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 27/63 - (42%) |
Similarity: | 43/63 - (68%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 PEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMK 129
|:::||||:|.||:|.|::||||:|.. .|::..:|||.:|..:|.|.:.|||..:.|:...|
Frog 73 PDIEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLTELVDVCQHVLNTFEASIKEYKEQK 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I11143 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H22239 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1398114at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004757 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto104898 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3912 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.010 |
|
Return to query results.
Submit another query.