DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cg and polr1d.2

DIOPT Version :9

Sequence 1:NP_001260563.1 Gene:l(2)37Cg / 35196 FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_017952449.1 Gene:polr1d.2 / 100495369 XenbaseID:XB-GENE-5852282 Length:140 Species:Xenopus tropicalis


Alignment Length:63 Identity:27/63 - (42%)
Similarity:43/63 - (68%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMK 129
            |:::||||:|.||:|.|::||||:|.. .|::..:|||.:|..:|.|.:.|||..:.|:...|
 Frog    73 PDIEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLTELVDVCQHVLNTFEASIKEYKEQK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 22/50 (44%)
RNA_pol_L 46..>80 CDD:279526 6/11 (55%)
polr1d.2XP_017952449.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11143
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22239
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0004757
OrthoInspector 1 1.000 - - oto104898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.