DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN6-p27 and Dctn6

DIOPT Version :9

Sequence 1:NP_609949.1 Gene:DCTN6-p27 / 35195 FlyBaseID:FBgn0086446 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001099555.1 Gene:Dctn6 / 290798 RGDID:1307549 Length:190 Species:Rattus norvegicus


Alignment Length:175 Identity:84/175 - (48%)
Similarity:117/175 - (66%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SENRIKILPKAVVCEESSLRGDITFSSGCVVHPSATVIADAGPIIIGENCIIEEYATVAHRLEPG 67
            ::..:||.|.||||.||.:|||:|.....|:||.|.:||:||||||||..:|||.|.:.:.....
  Rat     5 TQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIIIGEGNLIEEQALIINAHPDN 69

  Fly    68 AVWDVNN----ILSIGTHNVFEVGCQVEAAKIGDKNVFESKCYVGPGVTVSSGCVVGAGIKIHGS 128
            .:.|..:    .:.|||:|||||||..:|.|:||.||.|||.|||..|.::|||::||...::..
  Rat    70 IIPDTEDPEPKPMIIGTNNVFEVGCHSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCSLNTF 134

  Fly   129 QRLPENTIVYGEQGLQREAIDKQGSQTLQIDFLRKVLPNYHHLRK 173
            :.:||||::||...|:|...::...||||:|||.|:|||||||:|
  Rat   135 EAIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN6-p27NP_609949.1 LbH_Dynactin_6 8..173 CDD:100052 83/168 (49%)
Dctn6NP_001099555.1 LbH_Dynactin_6 10..179 CDD:100052 83/168 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341319
Domainoid 1 1.000 84 1.000 Domainoid score I8130
eggNOG 1 0.900 - - E1_KOG4042
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4792
Inparanoid 1 1.050 174 1.000 Inparanoid score I3985
OMA 1 1.010 - - QHG55965
OrthoDB 1 1.010 - - D1278795at2759
OrthoFinder 1 1.000 - - FOG0005451
OrthoInspector 1 1.000 - - oto97120
orthoMCL 1 0.900 - - OOG6_104025
Panther 1 1.100 - - LDO PTHR13072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3876
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.