DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN6-p27 and Dctn6

DIOPT Version :9

Sequence 1:NP_609949.1 Gene:DCTN6-p27 / 35195 FlyBaseID:FBgn0086446 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_006509157.1 Gene:Dctn6 / 22428 MGIID:1343154 Length:208 Species:Mus musculus


Alignment Length:193 Identity:85/193 - (44%)
Similarity:118/193 - (61%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SENRIKILPKAVVCEESSLRGDIT------------------FSSGCVVHPSATVIADAGPIIIG 49
            ::..:||.|.||||.||.:|||:|                  |....|:||.|.:||:|||||||
Mouse     5 TQKSVKIAPGAVVCVESEIRGDVTIECMWLSSPLRRNTSSQLFCPRTVIHPKARIIAEAGPIIIG 69

  Fly    50 ENCIIEEYATVAHRLEPGAVWDVNNI----LSIGTHNVFEVGCQVEAAKIGDKNVFESKCYVGPG 110
            |..:|||.|.:.:......:.|..:.    :.|||:|||||||..:|.|:||.||.|||.|||..
Mouse    70 EGNLIEEQALIINAHPDNIIPDTEDTEPKPMIIGTNNVFEVGCHSQAMKMGDNNVIESKAYVGRN 134

  Fly   111 VTVSSGCVVGAGIKIHGSQRLPENTIVYGEQGLQREAIDKQGSQTLQIDFLRKVLPNYHHLRK 173
            |.::|||::||...::..:.:||||::||...|:|...::...||||:|||.|:|||||||:|
Mouse   135 VILTSGCIIGACCSLNTFEAIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN6-p27NP_609949.1 LbH_Dynactin_6 8..173 CDD:100052 84/186 (45%)
Dctn6XP_006509157.1 LbH_Dynactin_6 10..197 CDD:100052 84/186 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837598
Domainoid 1 1.000 85 1.000 Domainoid score I8196
eggNOG 1 0.900 - - E1_KOG4042
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4792
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55965
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005451
OrthoInspector 1 1.000 - - oto93583
orthoMCL 1 0.900 - - OOG6_104025
Panther 1 1.100 - - LDO PTHR13072
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2477
SonicParanoid 1 1.000 - - X3876
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.