DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and AT1G68420

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_177009.1 Gene:AT1G68420 / 843171 AraportID:AT1G68420 Length:87 Species:Arabidopsis thaliana


Alignment Length:83 Identity:28/83 - (33%)
Similarity:49/83 - (59%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 LGDVFTISQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLDRLEDLVCDVVDRVL---KSPWGY 382
            :|||:|.:.::|||:|.|.|||||:..||.|..|...::.::..|.:|.|:...:|   :....|
plant     1 MGDVYTFAPTFRAEKSHTSRHLAEFWMVEVELAFAGVEEAMNCSEAVVKDMCTTLLEKCRDDMEY 65

  Fly   383 LVKELNPDF--KPPQKPF 398
            :|:::: :|  ..|..||
plant    66 MVEKVD-EFCIDRPLMPF 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 28/83 (34%)
AsnRS_cyto_like_N 137..219 CDD:239818
AsxRS_core 233..552 CDD:238399 28/83 (34%)
AT1G68420NP_177009.1 PLN02221 <1..>77 CDD:177867 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0017
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.