DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and AT1G07030

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_172184.1 Gene:AT1G07030 / 837214 AraportID:AT1G07030 Length:326 Species:Arabidopsis thaliana


Alignment Length:232 Identity:43/232 - (18%)
Similarity:72/232 - (31%) Gaps:75/232 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PDVQLDNRH-------IMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQT-----QV 288
            ||.:.:..|       .||.|.....|..|........:.|.:|.....:.|..:.:.     |.
plant    23 PDFKPEIAHDGLKFWQFMIAGSIAGSVEHMAMFPVDTIKTHMQALRPCPLKPVGIREAFRSIIQK 87

  Fly   289 EGGSTLFK-------------LKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSY--RAEQSRT 338
            ||.|.|::             ..||                      ..:.:|:.|  ..:|:.:
plant    88 EGPSALYRGIWAMGLGAGPAHAVYF----------------------SFYEVSKKYLSAGDQNNS 130

  Fly   339 RRHLAE--YTHVEAECPFLTFDDLLDRLE------DLVCDVVDRVLKSPW------GYLVKELNP 389
            ..|...  :..:.::..|...|.:..||:      ..|.|.|.|||:...      .|....|  
plant   131 VAHAMSGVFATISSDAVFTPMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVL-- 193

  Fly   390 DFKPPQKPFRRMN---YEDAIKWLKE---NNVTKDDG 420
                ...||..::   ||.|.|.|.|   :.::.::|
plant   194 ----MNAPFTAVHFATYEAAKKGLMEFSPDRISDEEG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 43/232 (19%)
AsnRS_cyto_like_N 137..219 CDD:239818
AsxRS_core 233..552 CDD:238399 43/232 (19%)
AT1G07030NP_172184.1 Mito_carr 32..123 CDD:395101 17/112 (15%)
Mito_carr 126..217 CDD:395101 22/96 (23%)
Mito_carr <244..320 CDD:395101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.