DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AsnRS and SLC25A28

DIOPT Version :9

Sequence 1:	NP_001260561.1	Gene:	AsnRS / 35194	FlyBaseID:	FBgn0086443	Length:	558	Species:	Drosophila melanogaster
Sequence 2:	NP_112489.3	Gene:	SLC25A28 / 81894	HGNCID:	23472	Length:	364	Species:	Homo sapiens

Alignment Length:	121	Identity:	31/121 - (25%)
Similarity:	47/121 - (38%)	Gaps:	20/121 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 LTLSTESSVVLFGTLKLV-----PEGKTAPGGHELNVDYWELIGLA---PPGGADAILNEEAQPD 237
            ||::.....:.|.|.:.:     |:.:..|..|.|:......:..|   |......:||  .|..
Human   232 LTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLN--TQES 294

  Fly   238 VQLDNRHIMIRGENTSKVLKMRSV-----VTQAFRGHYEARGYNEVTPPTLVQTQV 288
            :.| |.|  |.|..|......|:|     ||..||| .:||...:: |.|.:...|
Human   295 LAL-NSH--ITGHITGMASAFRTVYQVGGVTAYFRG-VQARVIYQI-PSTAIAWSV 345

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AsnRS	NP_001260561.1	AsnS	122..558	CDD:223096	31/121 (26%)
		AsnRS_cyto_like_N	137..219	CDD:239818	8/42 (19%)
		AsxRS_core	233..552	CDD:238399	19/61 (31%)
SLC25A28	NP_112489.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..28
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	40..60
		Solcar 1	70..158
		Mito_carr	71..161	CDD:395101
		Solcar 2	168..252		4/19 (21%)
		Mito_carr	169..253	CDD:395101	4/20 (20%)
		Solcar 3	259..352		26/94 (28%)
		Mito_carr	<279..356	CDD:395101	22/74 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1056670at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010