DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and Slc25a28

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_006231629.1 Gene:Slc25a28 / 688811 RGDID:1584155 Length:399 Species:Rattus norvegicus


Alignment Length:128 Identity:23/128 - (17%)
Similarity:41/128 - (32%) Gaps:46/128 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IGLAPPGGADAILNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPT 282
            :||...|....:|::.|.               |.::|:|.|..:..:        .|:.||...
  Rat   206 LGLGAAGCVATLLHDAAM---------------NPAEVVKQRMQMYNS--------PYHRVTDCV 247

  Fly   283 LVQTQVEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEY 345
            ....|.||....::       :|.||                .|::..::|....|...|.|:
  Rat   248 RAVWQNEGAGAFYR-------SYTTQ----------------LTMNVPFQAIHFMTYEFLQEH 287

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 23/128 (18%)