DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and Slc25a37

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_006252328.2 Gene:Slc25a37 / 306000 RGDID:1359361 Length:359 Species:Rattus norvegicus


Alignment Length:88 Identity:18/88 - (20%)
Similarity:29/88 - (32%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 CKEDQRLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGY 526
            ||......|::.:.|.||...:.|....:.:...|.|.       ..|:.....||...||....
  Rat   279 CKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGL-------AGYFKGIQARVIYQMPSTAI 336

  Fly   527 GLGLERFLCWLLNRYHIREVCLY 549
            ...:..|..:.|.:..:....||
  Rat   337 SWSVYEFFKYFLTKRQLENRTLY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 18/88 (20%)
AsnRS_cyto_like_N 137..219 CDD:239818
AsxRS_core 233..552 CDD:238399 18/88 (20%)
Slc25a37XP_006252328.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.