DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and Slc25a28

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_660138.1 Gene:Slc25a28 / 246696 MGIID:2180509 Length:364 Species:Mus musculus


Alignment Length:151 Identity:33/151 - (21%)
Similarity:50/151 - (33%) Gaps:43/151 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TAPG---GHELNVDYWE-----LIGLAPPGGADAILNEEAQPDVQLDNRHIMIRGENTSKVLKMR 259
            ||.|   .|.|....:|     |..:..|||...|.|..|.....|.:...|    |.::|:|.|
Mouse   137 TATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAM----NPAEVVKQR 197

  Fly   260 SVVTQAFRGHYEARGYNEVTPPTLVQTQVEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPALGDV 324
            ..:..:        .|:.||.......|.||....::       :|.||                
Mouse   198 MQMYNS--------PYHRVTDCVRAVWQNEGAGAFYR-------SYTTQ---------------- 231

  Fly   325 FTISQSYRAEQSRTRRHLAEY 345
            .|::..::|....|...|.|:
Mouse   232 LTMNVPFQAIHFMTYEFLQEH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 33/151 (22%)
AsnRS_cyto_like_N 137..219 CDD:239818 7/23 (30%)
AsxRS_core 233..552 CDD:238399 21/113 (19%)
Slc25a28NP_660138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Solcar 1 70..158 6/20 (30%)
Mito_carr 71..161 CDD:365909 7/23 (30%)
Solcar 2 168..252 22/118 (19%)
Mito_carr 169..253 CDD:365909 23/119 (19%)
Solcar 3 263..352
Mito_carr <279..355 CDD:365909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.