DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS and mfn-1

DIOPT Version :9

Sequence 1:NP_001260561.1 Gene:AsnRS / 35194 FlyBaseID:FBgn0086443 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_496447.1 Gene:mfn-1 / 174752 WormBaseID:WBGene00012204 Length:312 Species:Caenorhabditis elegans


Alignment Length:220 Identity:49/220 - (22%)
Similarity:70/220 - (31%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KRQQNLEDARKVKISEDPSLPV-ARKIRIYE-------GTANRDSRVKVYG-------WVH---- 145
            ||:..|...|.|......|:|. |....:||       |.:...|....||       .:|    
 Worm    68 KREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKGYLTGNSAGHSNTLAYGASGVVATLIHDAIM 132

  Fly   146 ---RLRRQGKSLIFITLRDGTGFLQCVLN-DQLCQTYDALTLSTESSVVL---------FGTLKL 197
               .:.:|...:.|..........:||.| :.:...|.:.|.....:|..         |....|
 Worm   133 NPAEVVKQRMQMAFSPYGSSLECARCVYNREGVAAFYRSYTTQLAMNVPFQAIHFMSYEFWQHVL 197

  Fly   198 VPEGKTAPGGHELNVDYWELI--GLAPPGGADA-----------ILNEEAQPDVQLDNRHIMIRG 249
            .||.|..|..|        ||  |||  ||..|           :||.:...:....||.|.::.
 Worm   198 NPEHKYDPKSH--------LIAGGLA--GGLAAALTTPMDCVKTVLNTQQAAEADPANRRIFLQA 252

  Fly   250 ENTSKVLKMRSVVTQAFRGHYEARG 274
            .     .:.|. ::.|.|..|..||
 Worm   253 R-----YRYRG-ISDAVRTIYSQRG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRSNP_001260561.1 AsnS 122..558 CDD:223096 42/197 (21%)
AsnRS_cyto_like_N 137..219 CDD:239818 20/107 (19%)
AsxRS_core 233..552 CDD:238399 9/42 (21%)
mfn-1NP_496447.1 Mito_carr 14..108 CDD:278578 11/39 (28%)
Mito_carr 110..197 CDD:278578 13/86 (15%)
Mito_carr <223..308 CDD:278578 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.