DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cd and l(2)37Cd

DIOPT Version :10

Sequence 1:NP_609947.1 Gene:l(2)37Cd / 35193 FlyBaseID:FBgn0086445 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_309990.5 Gene:l(2)37Cd / 1271233 VectorBaseID:AGAMI1_004636 Length:465 Species:Anopheles gambiae


Alignment Length:49 Identity:10/49 - (20%)
Similarity:21/49 - (42%) Gaps:16/49 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTFHLTSDYVPGYTLSDSRCFF--------------NSAVSRRTLAILP 39
            |.|::.:..:.|:  ||...|.              :|..::.|:|::|
Mosquito   261 GPFYICAILINGF--SDGLVFLLINWKQIGSQGQKVSSMSAKSTMAVIP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CdNP_609947.1 Tau95_N 16..115 CDD:465457 8/38 (21%)
Tau95 160..303 CDD:462865
l(2)37CdXP_309990.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.