DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cb and AT3G26560

DIOPT Version :10

Sequence 1:NP_609946.1 Gene:l(2)37Cb / 35192 FlyBaseID:FBgn0086444 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_189288.1 Gene:AT3G26560 / 822264 AraportID:AT3G26560 Length:1168 Species:Arabidopsis thaliana


Alignment Length:36 Identity:12/36 - (33%)
Similarity:20/36 - (55%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ELKPESSSFYQEEEDDDVTFD--VLSQDDGILDVLS 343
            :||||:..:|..:||..:...  .||:.:|...|:|
plant   142 DLKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CbNP_609946.1 PTZ00121 <6..267 CDD:173412
HrpA 251..>868 CDD:441249 12/36 (33%)
AT3G26560NP_189288.1 GH2-like_DHX8 9..76 CDD:409668
S1_DHX8_helicase 214..290 CDD:240189
HrpA 513..>1137 CDD:441249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.