DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cb and Zcchc17

DIOPT Version :10

Sequence 1:NP_609946.1 Gene:l(2)37Cb / 35192 FlyBaseID:FBgn0086444 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:116 Identity:22/116 - (18%)
Similarity:47/116 - (40%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEPDSEEESRLKDLQERDEFASRLKKRDDDRTRNVVDSTGGRRAIEEATKRLKLEHEDRDKIVPH 81
            ||.:.:||::.:.|::.|...:..:||..::.                    |.:|.||      
Mouse   160 EEEEEKEEAKAEGLEKPDPTKNSSRKRKKEKK--------------------KKKHRDR------ 198

  Fly    82 LRLQSRRQYLEKRKDDKVAELEADI-LDDEYLFDESVLTKREKEEREYKKQ 131
                       |..|...::.|:|. ....:...:|..||::|:::::||:
Mouse   199 -----------KSSDCDSSDSESDTGKKARHSSKDSKATKKKKKKKKHKKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CbNP_609946.1 PTZ00121 <6..267 CDD:173412 22/116 (19%)
HrpA 251..>868 CDD:441249
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241 22/116 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.