DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cb and zcchc17

DIOPT Version :9

Sequence 1:NP_609946.1 Gene:l(2)37Cb / 35192 FlyBaseID:FBgn0086444 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_956838.2 Gene:zcchc17 / 393516 ZFINID:ZDB-GENE-040325-2 Length:235 Species:Danio rerio


Alignment Length:154 Identity:31/154 - (20%)
Similarity:58/154 - (37%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDLQERDEFASRLKKRDDDRTRNVVDSTGGRRAIEEATKRLKLEHEDRDKIVPHLRLQSRRQYLE 92
            :||...:..|    ::|:.|.|...|.:|.|..:|........:...|.............||..
Zfish    99 RDLDPNNVIA----EQDERRRRQFRDHSGQRITLEAVLNTTCKKCGCRGHFAKDCFSSPGLQYSL 159

  Fly    93 KRKDDKVAELEADILDDEYLFDESVLTKREKEEREYKKQLLNIAKEHEKARELERIQRYNMPQDL 157
            ..::::...|...|...|        .::.|:|::.||:     |:.:|.|:.|.....:..:|.
Zfish   160 LPEEEEEEPLSTQITQSE--------PQKRKKEKKAKKE-----KKKKKERKRENSSSDSSNEDA 211

  Fly   158 KKGERSEYVEVDEFEKQPNSEQKK 181
            |:.:.|          ..:||:||
Zfish   212 KRPKHS----------HTHSEKKK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CbNP_609946.1 HrpA 222..867 CDD:224557
DEXDc 269..408 CDD:238005
HELICc 491..581 CDD:197757
HA2 651..735 CDD:214852
OB_NTP_bind 770..869 CDD:285018
zcchc17NP_956838.2 S1_pNO40 16..89 CDD:240191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.