DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddc and SEPSECS

DIOPT Version :9

Sequence 1:NP_724163.1 Gene:Ddc / 35190 FlyBaseID:FBgn0000422 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_016863766.1 Gene:SEPSECS / 51091 HGNCID:30605 Length:586 Species:Homo sapiens


Alignment Length:231 Identity:39/231 - (16%)
Similarity:73/231 - (31%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQG 181
            ||...|.::.::|.|           ....|:|:.|.    .|:.||..:.:.|           
Human   266 TAGFEPVVIENVLEG-----------DELRTDLKAVE----AKVQELGPDCILC----------- 304

  Fly   182 TASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS 246
              ..||..........:|:|:..:...:|...|:....|..|.:....:::...:|.:. ..|||
Human   305 --IHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRID-AFVQS 366

  Fly   247 ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGS 311
                     |:|..       ::|....:..|..:|    ::.|             :...|.|.
Human   367 ---------LDKNF-------MVPVGGAIIAGFNDS----FIQE-------------ISKMYPGR 398

  Fly   312 AFICPE--------------YRHLMKGIESADSFNF 333
            |...|.              |:.|:|  |..:.|::
Human   399 ASASPSLDVLITLLSLGSNGYKKLLK--ERKEMFSY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdcNP_724163.1 Pyridoxal_deC 70..446 CDD:278699 39/231 (17%)
SEPSECSXP_016863766.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.