Sequence 1: | NP_724163.1 | Gene: | Ddc / 35190 | FlyBaseID: | FBgn0000422 | Length: | 510 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016863766.1 | Gene: | SEPSECS / 51091 | HGNCID: | 30605 | Length: | 586 | Species: | Homo sapiens |
Alignment Length: | 231 | Identity: | 39/231 - (16%) |
---|---|---|---|
Similarity: | 73/231 - (31%) | Gaps: | 78/231 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 TANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQG 181
Fly 182 TASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS 246
Fly 247 ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGS 311
Fly 312 AFICPE--------------YRHLMKGIESADSFNF 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ddc | NP_724163.1 | Pyridoxal_deC | 70..446 | CDD:278699 | 39/231 (17%) |
SEPSECS | XP_016863766.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |