DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddc and SecS

DIOPT Version :9

Sequence 1:NP_724163.1 Gene:Ddc / 35190 FlyBaseID:FBgn0000422 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster


Alignment Length:357 Identity:76/357 - (21%)
Similarity:120/357 - (33%) Gaps:123/357 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 HTILGKLVGYCSDQAHSSVERAG--------------LLGGVKLRS------------------V 244
            |...|..:|...|...:..:.||              |:.|:.|.|                  :
  Fly    88 HYNFGHGIGRSGDLLEAQPKAAGSTLLARLTNALILDLIRGIGLPSCAGCFLVPMCTGMTLTLCL 152

  Fly   245 QSENHRMRGA--ALEKAIEQD------VAEGLIPFY---------------------------AV 274
            ||...|..||  .|...|:|.      .|.||:|..                           ::
  Fly   153 QSLRKRRPGARYVLWSRIDQKSCFKAITATGLVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSI 217

  Fly   275 VTLGTTNSC-AFDYLDECGPVGNKHNLW--IH-VDAAYAGSAFICPEYRHLMKGIESA------D 329
            :.|.||.|| |....|:...|......|  .| |:.||...|      :.::..:|.|      |
  Fly   218 LCLYTTTSCFAPRNSDDIAEVSKLSKQWQIPHLVNNAYGLQA------KEIVNQLECANRVGRID 276

  Fly   330 SFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDM--------QGS-APDYRHWQIPL 385
            .|..:..|.:||...         |.:|.:||...|   ||:        .|| :.|.....:.|
  Fly   277 YFVQSSDKNLLVPVG---------SAIVASFNESVL---HDVASTYAGRASGSQSLDVLMTLLSL 329

  Fly   386 GRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNE 450
            ||  ...:|.|..|......|:.::|:   ||:..|:: |.||||.   .|::.:....|.|...
  Fly   330 GR--NGFRLLFDQRGENFNYLRENLRK---FAEPRGEI-VIDSRFN---SISLAITLATLAGDQM 385

  Fly   451 RNEALLKRINGRGHIH-------LVPAKIKDV 475
            ::   :.::....|:.       :||.:.|.:
  Fly   386 KS---ITKLGSMLHMRGVSGARVIVPGQNKTI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdcNP_724163.1 Pyridoxal_deC 70..446 CDD:278699 70/319 (22%)
SecSNP_649556.3 AAT_I 12..457 CDD:302748 76/357 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.