DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddc and Sgpl1

DIOPT Version :9

Sequence 1:NP_724163.1 Gene:Ddc / 35190 FlyBaseID:FBgn0000422 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_008771093.2 Gene:Sgpl1 / 286896 RGDID:628599 Length:648 Species:Rattus norvegicus


Alignment Length:385 Identity:76/385 - (19%)
Similarity:130/385 - (33%) Gaps:129/385 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKVSIDMEAPEFKDFAKTMVD---FIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDV 91
            |.:.:|      ||:.||:..   ..||.||.::|...:...                   ||:.
  Rat   184 PFLKLD------KDYVKTLPAQGLSTAEVLERLKEYSSMDVF-------------------WQEG 223

  Fly    92 MQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDW 156
            ...       |..:...||              :.::|..|..  .||| ::|       :..|.
  Rat   224 KAS-------GAVYSGEPK--------------LTELLVQAYG--EFTW-SNP-------LHPDI 257

  Fly   157 LGKMLELPAEF--LACSGGKGG----GVIQGTASESTLVALLG----AKAKKLKEVKELHPEWDE 211
            ...:.:|.||.  :.||...||    |.:....:||.|:|...    |..|.:|..:.:.||   
  Rat   258 FPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPE--- 319

  Fly   212 HTILGKLVGYCSDQAHSSVERAGLLGGVKL-RSVQSENHRMRGAALEKAIEQDVA---------- 265
                         .||::.::|....|:|: |..|.:|..:...|:::||.::.|          
  Rat   320 -------------SAHAAFDKAAHYFGMKIVRVAQKKNMEVDVRAMKRAISRNTAMLVCSAPQFP 371

  Fly   266 EGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPE---------YRHL 321
            .|:|                |.:.|...:..|:.:..||||...|...:..|         :...
  Rat   372 HGVI----------------DPIPEVAKLAVKYKIPFHVDACLGGFLIVFMEKAGYPLEKPFDFR 420

  Fly   322 MKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDP-----LYLKHDMQGSAP 376
            :||:.|..:   :.||:.......|.:...:..:....|.||.     :|....:.||.|
  Rat   421 VKGVTSISA---DTHKYGYAPKGSSVVMYSNEKYRKYQFFVDADWQGGIYASPSIAGSRP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdcNP_724163.1 Pyridoxal_deC 70..446 CDD:278699 65/342 (19%)
Sgpl1XP_008771093.2 DOPA_deC_like 226..587 CDD:99743 63/318 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.