DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and SGPL1

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_003892.2 Gene:SGPL1 / 8879 HGNCID:10817 Length:568 Species:Homo sapiens


Alignment Length:418 Identity:86/418 - (20%)
Similarity:148/418 - (35%) Gaps:112/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IADYLENIRDDDVLPN-----VEPGYLLDLLPTEMPEEPEAWKDVLGDISRVIKPGLTHWQSPHM 76
            |.|.| |...||:..|     |:..| :..||::            |..|..:...|..:.|  |
Human    88 IQDKL-NKTKDDISKNMSFLKVDKEY-VKALPSQ------------GLSSSAVLEKLKEYSS--M 136

  Fly    77 HAYYPTSTSYPSI------VGEMLASGFGVIGFSWI------CSPACTELEVVVMDWLAKFLKLP 129
            .|::....:..::      :.|:|...:|  .|:|.      ..|...::|       |:.:::.
Human   137 DAFWQEGRASGTVYSGEEKLTELLVKAYG--DFAWSNPLHPDIFPGLRKIE-------AEIVRIA 192

  Fly   130 AHFQHASDGPGG-GVIQGSASEAVLVAVLAAREQAVANYRESHPELSESEVRGRLVAYSSDQSNS 193
            ...  .:.||.. |.:....:|::|:|..|.|:.|.....:: ||         :||..|  :::
Human   193 CSL--FNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKT-PE---------IVAPQS--AHA 243

  Fly   194 CIEKAGVLAAMPIRLLPAGEDFVLRGDTLRGAIEEDVAAGRIPVICVATLGTTGTCAYDDIESLS 258
            ...||.....|.|..:|..:...:....:|.||..:.|.    ::|.......|  ..|.:..::
Human   244 AFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAM----LVCSTPQFPHG--VIDPVPEVA 302

  Fly   259 AVCEEFKVWLHVDAAYAG--------GAFALEECSDLR-KGLDRVDSLNFNLHKFMLVNFDCSAM 314
            .:..::|:.|||||...|        ..:.||...|.| ||   |.|::.:.||:.......|.:
Human   303 KLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKG---VTSISADTHKYGYAPKGSSLV 364

  Fly   315 WLRDANKVVDSFNVDRIYLKHKHEGQSQIPDFRHWQIPL-------GRRFRALKV--WITFRTLG 370
            ...|.......|.||                 ..||..:       |.|...:..  |......|
Human   365 LYSDKKYRNYQFFVD-----------------TDWQGGIYASPTIAGSRPGGISAACWAALMHFG 412

  Fly   371 AEGLRNHVRKHIELAKQFEQLVLKDSRF 398
            ..|       ::|..||    ::|.:||
Human   413 ENG-------YVEATKQ----IIKTARF 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 78/395 (20%)
SGPL1NP_003892.2 DOPA_deC_like 144..507 CDD:99743 69/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.