DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Sepsecs

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001121759.1 Gene:Sepsecs / 679383 RGDID:1589491 Length:504 Species:Rattus norvegicus


Alignment Length:361 Identity:71/361 - (19%)
Similarity:128/361 - (35%) Gaps:76/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLRGDTLR---GAIEEDV-AAGR 234
            |.....:.:.:.:......||.:........|:.:     :.||.||.||   .|:|..: ..|.
  Rat   155 LRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVI-----ENVLEGDELRTDLKAVEAKIQELGP 214

  Fly   235 IPVICVATLGTTGTC----AYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDL-RKG--LD 292
            ..::|   |.:|..|    ..|.:|.|:.:|..:.:...|:.||   .....:|..| ::|  :.
  Rat   215 EHILC---LHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAY---GLQSSKCMHLIQQGARVG 273

  Fly   293 RVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIY-LKHKHEGQSQIPDFRHWQIPLGRR 356
            |:|....:|.|..:|..         ...::..||...|. :...:.|::....           
  Rat   274 RIDVFVQSLDKNFMVPV---------GGAIIAGFNDSFIQEISKMYPGRASASP----------- 318

  Fly   357 FRALKVWITFRTLGAEGLRNHVRKHIE----LAKQFEQLVLKDSRFELVAPR-----ALGLVCFR 412
              :|.|.||..:||..|.:..:::..|    |:.|.::|....:...|..|.     |:.|....
  Rat   319 --SLDVLITLLSLGCNGYKKLLKERKEMFAYLSTQLQKLAEAHNERLLKTPHNPISLAMTLETLD 381

  Fly   413 PKGDNEITTQLLQRLMDRK----------KIYMVKAEHAGRQFLRF----------VVCGMDTKA 457
            ...|..: |||...|..|:          .:..|.. |..|.|:..          ....:..|.
  Rat   382 GHQDRAV-TQLGSMLFTRQVSGARAVPLGSVQTVSG-HTFRGFMSHTDNYPCAYLNAAAAIGMKV 444

  Fly   458 SDIDFAWQEIESQLTDLQAEQSLVARKSGNVGDLAQ 493
            .|:|...:.::..|..::.||...:..||..|:.|:
  Rat   445 QDVDLFIKRLDKCLNTVRKEQRKASAVSGADGNKAE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 51/260 (20%)
SepsecsNP_001121759.1 selenium_SpcS 13..458 CDD:211833 64/337 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.