DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Sply

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster


Alignment Length:366 Identity:66/366 - (18%)
Similarity:145/366 - (39%) Gaps:68/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MPEEPEAWKDVLGDISRVIKPGLTHWQ----SPHMHAYYPTSTSYPSIVGEMLASGFGVIGFSWI 106
            :||:..:.:::|..:...:|.|..:|:    |..::.|.|.       :.|::...:|...::  
  Fly   103 LPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPD-------LVELVTEVYGKASYT-- 158

  Fly   107 CSPACTELEVVVMDWLAKFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRESH 171
             :|...:|...|....|:.:::..:..|.:....|.:..| .:|::::|:.|.|:.|    ||  
  Fly   159 -NPLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTG-GTESIVMAMKAYRDFA----RE-- 215

  Fly   172 PELSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLRGDTLRGAIEEDV-----A 231
               .:...|..:|...:  .::..:|.|....:.:|.:....:          ..|.|:     |
  Fly   216 ---YKGITRPNIVVPKT--VHAAFDKGGQYFNIHVRSVDVDPE----------TYEVDIKKFKRA 265

  Fly   232 AGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLR-------- 288
            ..|..::.|.:.........||||:::|:..::.:.:||||.......||...:..:        
  Fly   266 INRNTILLVGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEV 330

  Fly   289 KGLDRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLKHKHEGQSQIPDFRHWQIPL 353
            ||   |.|::.:.||:....        :.::.::.|   |:.|..|:....:..|...:.. |.
  Fly   331 KG---VTSISADTHKYGFAP--------KGSSVILYS---DKKYKDHQFTVTTDWPGGVYGS-PT 380

  Fly   354 GRRFRA----LKVWITFRTLGAEGLRNHVRKHIELAKQFEQ 390
            ....||    ...|.|..:.|.:|.....::.::.|:..|:
  Fly   381 VNGSRAGGIIAACWATMMSFGYDGYLEATKRIVDTARYIER 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 66/366 (18%)
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 60/337 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.