DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amd and Sgpl1

DIOPT Version :9

Sequence 1:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_008771093.2 Gene:Sgpl1 / 286896 RGDID:628599 Length:648 Species:Rattus norvegicus


Alignment Length:379 Identity:72/379 - (18%)
Similarity:133/379 - (35%) Gaps:105/379 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EMLASGFGVIGFSWI------CSPACTELEVVVMDWLAKFLKLPAHFQHASDGPGG-GVIQGSAS 149
            |:|...:|  .|:|.      ..|...:||..::.......         :.||.. |.:....:
  Rat   238 ELLVQAYG--EFTWSNPLHPDIFPGLRKLEAEIVRMTCSLF---------NGGPDSCGCVTSGGT 291

  Fly   150 EAVLVAVLAAREQAVANYRESHPELSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGED 214
            |::|:|..|.|:.|:....:: ||:           .:.:.:::..:||.....|.|..:...::
  Rat   292 ESILMACKAYRDLALEKGIKT-PEI-----------VAPESAHAAFDKAAHYFGMKIVRVAQKKN 344

  Fly   215 FVLRGDTLRGAIEEDVAAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAG--- 276
            ..:....::.||..:.|.    ::|.|.....|  ..|.|..::.:..::|:..||||...|   
  Rat   345 MEVDVRAMKRAISRNTAM----LVCSAPQFPHG--VIDPIPEVAKLAVKYKIPFHVDACLGGFLI 403

  Fly   277 -----GAFALEECSDLR-KGLDRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLKH 335
                 ..:.||:..|.| ||   |.|::.:.||:         .:....:.||       :|...
  Rat   404 VFMEKAGYPLEKPFDFRVKG---VTSISADTHKY---------GYAPKGSSVV-------MYSNE 449

  Fly   336 KHEGQSQIPDFRHWQIPLGRRFRALKV------------WITFRTLGAEGLRNHVRKHIELAKQF 388
            |:.......| ..||   |..:.:..:            |......|..|       ::|..|| 
  Rat   450 KYRKYQFFVD-ADWQ---GGIYASPSIAGSRPGGIIAACWAALMHFGENG-------YVEATKQ- 502

  Fly   389 EQLVLKDSRF---EL--------VAPRALGLVCFRPKGDNEITTQLLQRLMDRK 431
               ::|.:||   ||        :....|.::..   |.|:.....|..:|..|
  Rat   503 ---IIKTARFLKSELENIKNIFILGDPQLSVIAL---GSNDFDIYRLSNMMSAK 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 67/360 (19%)
Sgpl1XP_008771093.2 DOPA_deC_like 226..587 CDD:99743 72/379 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.